PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P30180_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 252aa    MW: 27853.4 Da    PI: 9.4962
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P30180_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-18107161256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++tk q   Le+ F+++ +++ +++++LA++l+L  rqV vWFqNrRa+ k
  GSMUA_Achr6P30180_001 107 RKKLRLTKGQSALLEDKFREHGTLNPKQKQDLAQQLNLRPRQVEVWFQNRRARSK 161
                            788899***********************************************98 PP

2HD-ZIP_I/II111.94.3e-36107196190
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rl+k q++lLE++F+e+ +L+p++K++la++L+l+prqv+vWFqnrRAR k+k++E++ e+L++++++l+een rL++e +eL+
  GSMUA_Achr6P30180_001 107 RKKLRLTKGQSALLEDKFREHGTLNPKQKQDLAQQLNLRPRQVEVWFQNRRARSKLKKTEVELEFLRKCCERLTEENIRLQEELQELK 194
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 ee 90 
                            ++
  GSMUA_Achr6P30180_001 195 SQ 196
                            76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.682103163IPR001356Homeobox domain
SMARTSM003894.3E-15105167IPR001356Homeobox domain
SuperFamilySSF466897.7E-17106172IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-17107161IPR009057Homeodomain-like
PfamPF000465.9E-16107161IPR001356Homeobox domain
CDDcd000861.34E-15107164No hitNo description
PROSITE patternPS000270138161IPR017970Homeobox, conserved site
SMARTSM003407.9E-14163206IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MCSTGLSLAL NYYGKSTDSS VGNRPRPSSR LELEISSSAA AAIEPSLTLG LPGDGRKAWS  60
VGTQSSPTHS VMSSFPGGHP SKINGENDEA EKIWPRISDE EEYGTARKKL RLTKGQSALL  120
EDKFREHGTL NPKQKQDLAQ QLNLRPRQVE VWFQNRRARS KLKKTEVELE FLRKCCERLT  180
EENIRLQEEL QELKSQKSLA PRYTQLHEAA PAFAMCPSCN KVTGASDGSG SGLLVAASKR  240
HFSNPFAHCA AR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009406588.10.0PREDICTED: homeobox-leucine zipper protein HAT9-like
SwissprotA2XE766e-57HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL46e-57HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLM0TBG30.0M0TBG3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P30180_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-56HD-ZIP family protein